Search results

Filter

Filetype

Your search for "*" yielded 540632 hits

Unified model of fractal conductance fluctuations for diffusive and ballistic semiconductor devices

We present an experimental comparison of magnetoconductance fluctuations measured in the ballistic, quasiballistic, and diffusive scattering regimes of semiconductor devices. In contradiction to expectations, we show that the spectral content of the magnetoconductance fluctuations exhibits an identical fractal behavior for these scattering regimes and that this behavior is remarkably insensitive t

Temperaturmätningar i tegelskorsten vid oljeeldning med låg effekt

Rapport avseende mätningar utförda i experimentanläggning vid Institutionen för Byggnadskonstruktionslära, Lunds Tekniska Högskola. Projektet är en direkt fortsättning av projektet "Temperatur- och fuktmätningar i skorsten vid omväxlande olje- och elvärme (BKL 1986:26)

Effect of active site-inactivated factor VIIa on ischaemia/reperfusion injury in a porcine flap model.

In free flap surgery, restored blood flow following a lengthy ischaemic period may lead to necrosis as a result of ischaemia/reperfusion (IR) injury. This injury comprises both proinflammatory and prothrombotic events, where the tissue factor/factor VIIa complex probably has a key role. Active site-inactivated factor VIIa (FFR-rFVIIa) exerts an antithrombotic effect by binding to tissue factor wit

Emotion and social motivation in university students´ real life moral dilemmas

Studied the relationship between motivation and approaches to moral decision-making, and the emotions experienced in moral dilemmas. 44 students were interviewed about a dilemma they had faced. Intimacy was related to a preference for making decisions after having consulted others and to being open to their values and norms, whereas achievement was related to consequence-oriented reasoning and con

Bactericidal and hemolytic properties of mixed LL-37/surfactant systems

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Measurement of protein diffusion through poly(D,L-lactide-co-glycolide)

A novel method was developed for studying the diffusion of proteins through poly(D,L-lactide-co-glycolide) (PLG), using a diffusion cell. To develop improved formulations for the controlled release of encapsulated drugs it is important to understand the underlying release mechanisms. When using low-molecular-weight PLG as the release-controlling polymer, diffusion through the pores is often propos

Sintering of alumina-supported nickel particles under amination conditions: Support effects

The sintering of alumina-supported nickel particles has been studied after heat-treatment in ammonia + hydrogen at 523 K and 250 bar. The investigated samples were nickel supported on gamma-alumina, transalumina and alpha-alumina, and co-precipitated nickel oxide-alumina. The sintering process was mainly followed by hydrogen chemisorption. The samples were also characterised by specific surface ar

Lipoic acid increases glutathione production and enhances the effect of mercury in human cell lines.

Thiols are known to influence the metabolism of glutathione. In a previous study (Toxicology 156 (2001) 93) dithiothreitol (DTT) did not show any effect on intra- or extracellular glutathione concentrations in HeLa cell cultures but increased the effects of mercury ions on glutathione concentrations, whereas monothiols such as N-acetylcysteine (NAC) or glutathione did not. In the present study, we

SCADA data and the quantification of hazardous events for QMRA

The objective of this study was to assess the use of on-line monitoring to support the QMRA at water treatment plants studied in the EU MicroRisk project. SCADA data were obtained from diary records, grab three Catchment-to-Tap Systems (CTS) along with system descriptions, sample data and deviation reports. Particular attention was paid to estimating hazardous event frequency, duration and magnitu

Thermal radiation heat transfer and biomass combustion in a large-scale fixed bed boiler

The main focus of this work is to investigate the performance of some simple radiation models used in the thermal radiative heat transfer calculations in a 55 MWe fixed bed boiler with wet wood-chips as the fuel. An optically thin approach, Rosseland approximation, and the P1-approximation were utilised in the investigation. A new optimised version, as it comes to computational speed, o

Spectroscopic studies of wood-drying processes

By the use of wavelength-modulation diode laser spectroscopy, water vapor and oxygen are detected in scattering media nonintrusively, at 980 nm and 760 nm, respectively. The technique demonstrated is based on the fact that free gases have extremely sharp absorption structures in comparison with the broad features of bulk material. Water vapor and oxygen measurements have been performed during the

Dietary fibre in type II diabetes

Recent studies have indicated that diets rich in digestible carbohydrates and dietary fibre might be beneficial in the regulation of type II non insulin dependent diabetes (NIDD). Addition of the gel forming type of dietary fibre such as pectin and guar gum to meals or glucose solutions reduces post-prandial glucose and insulin response. Addition of cereal fibres in the form of bran seems to have

Are current rapid detection tests for Group A Streptococci sensitive enough? Evaluation of 2 commercial kits

A new, 1-step, enzyme-linked immunoassay kit for detection of Group A Streptococci (GAS) in throat samples (QuickVue In-Line One-Step Strep A Test; Quidel Corporation, San Diego, CA) was evaluated for use in a study comprising 536 patients in 8 primary healthcare centres. Compared to conventional culture at the clinical microbiology laboratory, the sensitivity achieved was 73.9% and the specificit

Miscarriages and stillbirths in women with a high intake of fish contaminated with persistent organochlorine compounds

OBJECTIVES: The purpose of the present study was to assess the effect, on miscarriages and stillbirths, of persistent organochlorine compounds (POC) through dietary intake of fatty fish from the Baltic Sea. METHODS: Information on miscarriages and stillbirths was collected retrospectively by a self-administered questionnaire in a cohort of fishermen's wives from the Swedish east coast (by the Balt

Genetic and nongenetic factors associated with variation of plasma levels of insulin-like growth factor-I and insulin-like growth factor-binding protein-3 in healthy premenopausal women

Circulating levels of insulin-like growth factor-I (IGF-I) and insulin-like growth factor-binding protein 3 (IGFBP-3) vary considerably between normal individuals. Recent epidemiological studies have provided evidence that these levels are predictive of risk of several common cancers. To evaluate possible sources of variation of the levels of circulating IGF-I and IGFBP-3 in females, we studied sp

Att bli konstnär : Om identitet, subjektivitet och konstnärskap i det senmoderna samhället

Popular Abstract in Swedish I denna avhandling ställs frågan varför unga människor vill bli konstnärer och vilken mening det konstnärliga skapandet kan tänkas ge dem. En grupp unga konstelever har intervjuats och för var och en av de intervjuade är konstens mening högst personlig samtidigt som mening också skapas i den konstnärliga gemenskap eleverna ingår i. Författaren vill försöka förstå både dThis dissertation explore young peoples will to become artists. A group of artstudents have been interviewed and severel questions are raised. How do the students perceive their artistry and their role as artists? In what way is artistic creation meaningful to them? What does the relationship between the individual project of becoming an artist and their societal participation look like? As artist